IthaID: 536


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 45 CAC>CGC [His>Arg] HGVS Name: HBA1:c.137A>G
Hb Name: Hb Fort de France Protein Info: α1 45(CE3) His>Arg

Context nucleotide sequence:
CCCACCACCAAGACCTACTTCCCGC [A/G] CTTCGACCTGAGCCACGGCTCTGCC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPRFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37833
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French West Indies
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
226Hb Fort de Franceα1D-10Dual Kit Program64.11.66Heterozygote. Elutes in the window of HbA2.[PDF]
227Hb Fort de Franceα1VARIANTβ-thal Short Program16.33.52Heterozygote. Elutes in the window of HbA2.[PDF]
232Hb Fort de Franceα1D-10Dual Kit Program16.13.06Compound heterozygote. In this case HbA0 is a result of transfusion.[PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Braconnier F, Gacon G, Thillet J, Wajcman H, Soria J, Maigret P, Labie D, Rosa J, Hemoglobin Fort de France (alpha2(45)(CD3) His replaced by Arg beta2). A new variant with increased oxygen affinity., Biochim. Biophys. Acta , 493(1), 228-33, 1977
  2. Cash FE, Monplaisir N, Goossens M, Liebhaber SA, Locus assignment of two alpha-globin structural mutants from the Caribbean basin: alpha Fort de France (alpha 45 Arg) and alpha Spanish Town (alpha 27 Val)., Blood , 74(2), 833-5, 1989
Created on 2010-06-16 16:13:15, Last reviewed on 2021-03-04 12:50:26 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.