IthaID: 506

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 31 AGG>AGC [Arg>Ser] HGVS Name: HBA2:c.96G>C
Hb Name: Hb Prato Protein Info: α2 31(B12) Arg>Ser
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CCCCTCACTCTGCTTCTCCCCGCAG [G/C] ATGTTCCTGTCCTTCCCCACCACCA (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALESMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Replacement of the arginine residue (charged) by serine (uncharged) at position α31 of the B-helix (B12), which lies in the α1β1 interface. The mutation weakens α31 contacts with residues of the β chain, thereby disrupting α1β1 dimerization with subsequent accumulation of free globin subunits. The mutation also destabilizes free α chains by inhibiting their binding to the chaperone AHSP. Unstable in isopropanol and heat denaturation tests. Near normal red cell indices (anisocytosis and hypochromia) and some evidence of inclusion bodies. Normal values for P50 O2, cooperativitiy and Bohr effect. Does not appear to cause clinical abnormalities. Discovered initially in two Italian families (from Tuscany and Calabria) and co-inherited with α-thalassaemia in a Taiwanese.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 33988
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Italian, Taiwanese
Molecular mechanism: Altered α1β1 interface
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Marinucci M, Mavilio F, Massa A, Gabbianelli M, Fontanarosa PP, Camagna A, Ignesti C, Tentori L, A new abnormal human hemoglobin: Hb Prato (alpha 2 31 (B12) Arg leads to Ser beta 2)., Biochim. Biophys. Acta , 578(2), 534-40, 1979
  2. De Marco EV, Crescibene L, Pasqua A, Brancati C, Bria M, Qualtieri A, HB Prato [alpha 31(B12)Arg----Ser] in a Calabrian family., Hemoglobin , 16(4), 275-9, 1992
  3. Shih MC, Peng CT, Chang JY, Liu SC, Kuo PL, Chang JG, Hb Prato [alpha31(B12)Arg --> Ser (A2)] and alpha-thalassemia in a Taiwanese., Hemoglobin , 27(1), 45-7, 2003
  4. Thom CS, Dickson CF, Gell DA, Weiss MJ, Hemoglobin variants: biochemical properties and clinical correlates., Cold Spring Harb Perspect Med, 3(3), a011858, 2013
Created on 2010-06-16 16:13:15, Last reviewed on 2021-04-07 10:06:05 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.