IthaID: 434


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 1 GTG>GCG [Val>Ala] HGVS Name: HBA2:c.5T>C
Hb Name: Hb Lyon-Bron Protein Info: α2 1(NA1) Val>Ala

Context nucleotide sequence:
CAGACTCAGAGAGAACCCACCATGG [A/C/G/T] GCTGTCTCCTGCCGACAAGACCAAC (Strand: +)

Protein sequence:
MALSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 33780
Size: 1 bp
Located at: α2
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
109Hb Lyon-Bronα2D-10Dual Kit Program28.71.42Heterozygous. Slightly decreased oxygen affinity, mild anaemia.[PDF]
110Hb Lyon-Bronα2VARIANTβ-thal Short Program30.71.73Heterozygous. Slightly decreased oxygen affinity, mild anaemia. [PDF]
111Hb Lyon-Bronα2VARIANT IIβ-thal Short Program30.11.82Heterozygous. Slightly decreased oxygen affinity, mild anaemia.[PDF]
113Hb Lyon-Bronα2VARIANT IIDual Kit Program29.91.502Heterozygous. Slightly decreased oxygen affinity, mild anaemia.[PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Lacan P, Souillet G, Aubry M, Promé D, Richelme-David S, Kister J, Wajcman H, Francina A, New alpha 2 globin chain variant with low oxygen affinity affecting the N-terminal residue and leading to N-acetylation [Hb Lyon-Bron alpha 1(NA1)Val --> Ac-Ala]., Am. J. Hematol. , 69(3), 214-8, 2002
Created on 2010-06-16 16:13:15, Last reviewed on 2014-03-12 15:17:37 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.