IthaID: 4121

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 29 CTG>ATG [Leu>Met] HGVS Name: HBA2:c.88C>A
Hb Name: Hb Basurto Protein Info: α2 29(B10) Leu>Met
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GCTGGCGAGTATGGTGCGGAGGCC [C/A] TGGAGAGGTGAGGCTCCCTCCCCTG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEAMERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: The c.88C>A variant is located on exon 1 of the HBA2 gene. It was found incidentally in a 72-year-old man in the heterozygous state, clinically asymptomatic. No abnormal Hb variant (HbX) was separated by capillary electrophoresis or cation exchange HPLC, nor could an abnormal HbX globin chain be isolated by reversed-phase HPLC.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 33863
Size: 1 bp
Located at: α2
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Caucasian/Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Cruz Iglesias, Elena2025-01-13First report.
Created on 2025-01-16 11:54:08, Last reviewed on 2025-03-14 09:25:11 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.