IthaID: 4108


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 10 GCC>GTC [Ala>Val] HGVS Name: HBB:c.31_32insT
Hb Name: N/A Protein Info: β 10(A7) Ala>Val

Context nucleotide sequence:
GCATCTGACTCCTGAGGAGAAGTCT [-/T] CCGTTACTGCCCTGTGGGGCAAGGT (Strand: -)

Protein sequence:
MVHLTPEEKSVVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found in three Syrian immigrants during an update of the variant spectrum in the HBB gene in Turkey. The T insertion causes a frameshift that introduces a premature stop codon thirteen amino acids downstream in the new reading frame (p.Ala11ValfsTer13). In silico genetic prediction tools evaluate this variant to be likely pathogenic according to the recommendations of the ACMG.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70625
Size: 1 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Insertion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Syrian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Kocak Eker H, Balasar O, Distinct Distribution of HBB Variants in Two Cohorts of Beta Thalassemia Patients, and a Novel Variant from Turkey., Mol Syndromol, 15(5), 362-370, 2024
Created on 2024-10-14 10:18:54, Last reviewed on 2024-10-14 10:24:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.