
IthaID: 4107
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 47 GAC>AAC [Asp>Asn] | HGVS Name: | HBA2:c.142G>A |
Hb Name: | Hb Arya | Protein Info: | α2 47(CE5) Asp>Asn |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CACCAAGACCTACTTCCCGCACTTC [G/A] ACCTGAGCCACGGCTCTGCCCAGGT (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFNLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Comments: Hb Arya was first described in an Iranian family in 1974. A recent report described Hb Arya in a Malaysian family. Both potentials were clinically asymptomatic. This abnormal haemoglobin has an electrophoretic mobility very close to that of Hb S, thereby mimicking an electrophoretic pattern of the Hb S carrier.
External Links
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 34034 |
Size: | 1 bp |
Located at: | α2 |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Iranian, Malay |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- Rahbar S, Mahdavi N, Nowzari G, Mostafavi I, Haemoglobin Arya: alpha 2-47 (CD5), aspartic acid yields asparagine., Biochim. Biophys. Acta , 386(2), 525-9, 1975
- Nahanthiran S, Nik Mustapha NH, Yasin N, Idris FB, Md Noor SB, Family study of haemoglobin Arya in a Malaysian family., Malays J Pathol, 46(2), 315-320, 2024
Created on 2024-09-05 12:58:21,
Last reviewed on 2024-09-05 13:01:20 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.