IthaID: 4097


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 17 AAA>CAA [Lys>Gln] HGVS Name: HBD:c.52A>C
Hb Name: Hb A2-Laibin Protein Info: N/A

Context nucleotide sequence:
CTCACCACCAACTGCATCCACGTTCACTT [A>C] GCCCCACAGGGCATTGACAGCAGTCTTC (Strand: +)

Protein sequence:
MVHLTPEEKTAVNALWGQVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found as a novel Hb variant in a 36-year-old Chinese male without obvious clinical presentation. Hb A2 peak appeared into two fractions (Hb A2 and Hb A2-Laibin) on the capillary 2 Flex Piercing device. The electrophoresis position of Hb A2-Laibin is located at Z6 (D) zone.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: δ-thalassaemia
Allele Phenotype:N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63234
Size: 1 bp
Located at: δ
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Li, Youqiong2024-03-22First report.
Created on 2024-03-26 09:35:56, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.