IthaID: 4097
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 17 AAA>CAA [Lys>Gln] | HGVS Name: | HBD:c.52A>C |
| Hb Name: | Hb A2-Laibin | Protein Info: | N/A |
Context nucleotide sequence:
CTCACCACCAACTGCATCCACGTTCACTT [A>C] GCCCCACAGGGCATTGACAGCAGTCTTC (Strand: +)
Protein sequence:
MVHLTPEEKTAVNALWGQVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Found as a novel Hb variant in a 36-year-old Chinese male without obvious clinical presentation. Hb A2 peak appeared into two fractions (Hb A2 and Hb A2-Laibin) on the capillary 2 Flex Piercing device. The electrophoresis position of Hb A2-Laibin is located at Z6 (D) zone.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
No available links
Phenotype
| Hemoglobinopathy Group: | Thalassaemia |
|---|---|
| Hemoglobinopathy Subgroup: | δ-thalassaemia |
| Allele Phenotype: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 63234 |
| Size: | 1 bp |
| Located at: | δ |
| Specific Location: | Exon 1 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | Chinese |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
| A/A | Contributor(s) | Date | Comments |
|---|---|---|---|
| 1 | Li, Youqiong | 2024-03-22 | First report. |