IthaID: 4012


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 123 ACC>GCC [Thr>Ala] HGVS Name: HBD:c.370A>G
Hb Name: Hb A2-Kuching Protein Info: N/A

Context nucleotide sequence:
CCGCAACTTTGGCAAGGAATTC [A>G] CCCCACAAATGCAGGCTGCCTA (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFAPQMQAAYQKVVAGVANALAHKYH

Also known as:

Comments: The mutation changes threonine to alanine. It was found on three individuals. The 1st patient had HbA2 of 2% and was negative for the common alpha thalassemia (gap and arms panels). The 2nd patient had HbA2 of 1.7% with alpha 3.7kb deletion. The 3rd patient had HbA2 of 1.4%, however alpha thalassemia was not investigated. No HbA2’ in all patients.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 64578
Size: 1 bp
Located at: δ
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Malay
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Syahzuwan, Hassan2023-01-25First report.
Created on 2023-01-27 12:18:23, Last reviewed on 2023-03-13 15:12:12 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.