IthaID: 4012
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 123 ACC>GCC [Thr>Ala] | HGVS Name: | HBD:c.370A>G |
| Hb Name: | Hb A2-Kuching | Protein Info: | N/A |
Context nucleotide sequence:
CCGCAACTTTGGCAAGGAATTC [A>G] CCCCACAAATGCAGGCTGCCTA (Strand: -)
Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFAPQMQAAYQKVVAGVANALAHKYH
Also known as:
Comments: The mutation changes threonine to alanine. It was found on three individuals. The 1st patient had HbA2 of 2% and was negative for the common alpha thalassemia (gap and arms panels). The 2nd patient had HbA2 of 1.7% with alpha 3.7kb deletion. The 3rd patient had HbA2 of 1.4%, however alpha thalassemia was not investigated. No HbA2’ in all patients.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
No available links
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | δ-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 64578 |
| Size: | 1 bp |
| Located at: | δ |
| Specific Location: | Exon 3 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | Malay |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
| A/A | Contributor(s) | Date | Comments |
|---|---|---|---|
| 1 | Syahzuwan, Hassan | 2023-01-25 | First report. |