IthaID: 4007


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 70 GTG>TTG [Val>Leu] HGVS Name: HBA1:c.211G>T
Hb Name: N/A Protein Info: N/A

Context nucleotide sequence:
GGTGGCCGACGCGCTGACCAACGCC [G>T] TGGCGCACGTGGACGACATGCCCAA (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNALAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as: g.494 (GenBank MK600512.1)

Comments: Reported among alpha-thalassemia patients followed-up in a clinic in the south of Thi Qar province.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: α-thalassaemia
Allele Phenotype:α⁺
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37907
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Iraqi
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Odah Al-Musawi AH, Jumaah Alhussna A, Hussein Jalood H, Genetic Analysis of Alpha-Thalassemia Mutations in Thi-Gar Province, Iraq., Arch Razi Inst, 77(3), 976-980, 2022
Created on 2023-01-23 12:18:02, Last reviewed on 2023-01-23 12:23:02 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.