IthaID: 398

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 109 (-C) HGVS Name: HBA1:c.328delC
Hb Name: Hb Sciacca Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CTAAGCCACTGCCTGCTGGTGACC [C/-] TGGCCGCCCACCTCCCCGCCGAGT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTWPPTSPPSSPLRCTPPWTSSWLL*

Comments: Reported in literature as CD 108 (-C), which does not follow the HGVS Sequence Variant Nomenclature recommendations. The C deletion at codon 109, results in a frameshift, that gives rise to a premature stop codon at position 132 leading to a truncated protein. An update report revealed no abnormal band by HPLC and electrophoresis. However, both qualitative and semiquantitative analyses of the mRNA from a Sicilian patient’s reticulocytes revealed a decrease in mutant mRNA constituted 15% (Hb Sciacca) of total α1-globin mRNA. The analyses of the 3D models indicate that the Hb Sciacca is unstable. In a different report, the C deletion found in compound heterozygosity with --MED I (IthaID: 312), leading to Hb H disease.

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-thalassaemia, α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: Haemolytic anaemia [HP:0001878]

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34362
Size: 1 bp
Located at: α1
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Jewish, African, Egyprtian, Cypriot, Sicilian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Oron-Karni V, Filon D, Shifrin Y, Fried E, Pogrebijsky G, Oppenheim A, Rund D, Diversity of alpha-globin mutations and clinical presentation of alpha-thalassemia in Israel., American journal of hematology, 65(3), 196-203, 2000
  2. Henderson SJ, Timbs AT, McCarthy J, Gallienne AE, Proven M, Rugless MJ, Lopez H, Eglinton J, Dziedzic D, Beardsall M, Khalil MS, Old JM, Ten Years of Routine α- and β-Globin Gene Sequencing in UK Hemoglobinopathy Referrals Reveals 60 Novel Mutations., Hemoglobin , 40(2), 75-84, 2016
  3. Cardiero G, Musollino G, Prezioso R, Lacerra G, mRNA Analysis of Frameshift Mutations with Stop Codon in the Last Exon: The Case of Hemoglobins Campania [α1 cod95 (-C)] and Sciacca [α1 cod109 (-C)]., Biomedicines, 9(10), , 2021

Microattributions

A/AContributor(s)DateComments
1Petrou, Miranda2022-10-03Report of an update.
Created on 2010-06-16 16:13:15, Last reviewed on 2024-02-22 09:30:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.