IthaID: 3969


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 44 TCC>TTC [Ser>Phe] HGVS Name: HBB:c.134C>T
Hb Name: Hb Narges Lab Protein Info: β 44(CD3) Ser>Phe

Context nucleotide sequence:
CCTTGGACCCAGAGGTTCTTTGAGT [C/T] CTTTGGGGATCTGTCCACTCCTGAT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFEFFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found in a case presented with no hematological abnormalities. The variant was predicted to be disease-causing in all except one in silico prediction tools.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70858
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Persian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Hamid M, Shahbazi Z, Keikhaei B, Galehdari H, Saberi A, Sedaghat A, Shariati G, Mohammadi-Anaei M, Hb Narges Lab, a Novel Hemoglobin Variant of the β-Globin Gene., Arch Iran Med, 25(5), 339-342, 2022
Created on 2022-09-07 14:50:28, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.