
IthaID: 3916
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 15 GGT>TGT [Gly>Cys] | HGVS Name: | HBA2:c.46G>T |
Hb Name: | Hb Orbassano | Protein Info: | α2 15(A13) Gly>Cys |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CAAGACCAACGTCAAGGCCGCCTGG [G/T] GTAAGGTCGGCGCGCACGCTGGCGA (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWCKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Comments: Found in a healthy heterozygous patient presented with Hb 12.6 g/dL, MCV 83 fL, MCH 31.5 pg and RBC 4.8 10^12/L. Capillary electrophoresis shown that the HbX variant migrated in zone 13 with HbX level 13.1% and HbA2 2.5%. No separation of HbX and HbA found with HPLC analysis.
External Links
No available links
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 33821 |
Size: | 1 bp |
Located at: | α2 |
Specific Location: | Exon 1 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Caucasian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Mandrile, Giorgia | 2022-04-07 | First report. |
2 | Nicolò , Cinzia | 2022-04-07 | First report. HPLC and capillary electrophoresis analyses |
3 | Curcio , Cristina | 2022-04-07 | First report. Molecular analysis |