IthaID: 3861


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 87 (-A) HGVS Name: HBA1:c.263delA
Hb Name: N/A Protein Info: N/A

Context nucleotide sequence:
GCGCTGTCCGCCCTGAGCGACCTGC [A/-] CGCGCACAAGCTTCGGGTGGACCCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLPRTSFGWTRSTSSSX

Also known as:

Comments: Found in a 28-year-old female with mild anemia. Τhe A deletion, causing a frameshift that introduces a premature stop codon fourteen amino acids further down the new reading frame (codon 101 of HBA1 gene).

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: α-thalassaemia
Allele Phenotype:α⁺
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37959
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Liu L, Sun Y, Chen S, Yu C, Cao P, Sun J, Peng Z, Mao P, Identification of Two Novel Thalassemia Variants, : c.263delA and : c.376dupC, in Chinese Individuals., Hemoglobin, 45(1), 49-51, 2021
Created on 2021-09-24 11:34:55, Last reviewed on 2022-07-12 11:20:42 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.