IthaID: 3855

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 60 GTG>-TG [Val>STOP] HGVS Name: HBB:c.181delG
Hb Name: N/A Protein Info: β60 (E4) Val>STOP
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGATGCTGTTATGGGCAACCCTAAG [G>-] TGAAGGCTCATGGCAAGAAAGTGCT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKX

Comments: The frameshift mutation results in a premature termination codon at codon 60 in exon 2 of HBB.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70905
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Nonsense codon (Translation)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Chen X, Lin Z, Hu J, Chen S, Wen S, Wu A, Wu H, Huang J, Wang H, Sun J, Peng Z, Sun Y, Fu S, Report of Two Novel Thalassemia Variants, : c.181delG and : c.121_126delAAGACC, in Chinese Individuals., Hemoglobin, 45(1), 52-55, 2021
Created on 2021-09-23 12:54:14, Last reviewed on 2022-07-12 11:26:07 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.