IthaID: 3843
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 120 AAG>ACG [Lys>Thr] | HGVS Name: | HBD:c.362A>C |
Hb Name: | Hb A2-Liangqing | Protein Info: | N/A |
Context nucleotide sequence:
GTGTGCTGGCCCGCAACTTTGGCA [A>C] GGAATTCACCCCACAAATGCAGGC (Strand: -)
Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGTEFTPQMQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Found as a novel Hb variant in a 33-year-old Chinese male with normal hematological parameters (Hb 16. 0g/dL, RBC 5.54×10^12/L, MCV 88.6 fL, MCH 28.9pg). No clinical presentation. Detected by capillary electrophoresis at Z6 zone. Splitting of the Hb A2 peark into two fractions (Hb A2 and Hb A2-Liangqing on the capillary 2 Flex Piercing device). The results of patient are as follow: Hb A 97.4% ,Hb F 0%, Hb A2 1.5%, Hb A2-Liangqing 1.1%.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
No available links
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | δ-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 64570 |
Size: | 1 bp |
Located at: | δ |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Chinese |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Li, Youqiong | 2021-08-17 | First report. |
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2021-08-18 08:53:01 | The IthaGenes Curation Team | Created |