IthaID: 3798


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 69 GGT>TGT [Gly>Cys] HGVS Name: HBB:c.208G>T
Hb Name: Hb Miguel Servet Protein Info: β 69(E13) Gly>Cys

Context nucleotide sequence:
GAAGGCTCATGGCAAGAAAGTGCTC [G>T] GTGCCTTTAGTGATGGCCTGGCTCA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLCAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found in an 8-month-old Spanish girl and her mother. The Hb variant detected by CE-HPLC newborn (BioRad), by CZE and by CE-HPLC-CE Tosoh G8-2 (Horiba), but no by CE-HPLC-CE β-thalassaemia short programme (BioRad).

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70932
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Recasens V, Montañés Á, Rodríguez-Vigil C, González Y, Hernández de Abajo G, Nieto JM, González Fernández B, González-Fernández FA, Villegas A, Benavente C, Ropero P, Why is the novel Hb Miguel Servet visualised by CE-HPLC newborn and not by the CE-HPLC β-thalassaemia programme?, J Clin Pathol, 74(3), 198-201, 2021
Created on 2021-06-14 16:00:54, Last reviewed on 2022-10-19 15:14:32 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.