IthaID: 3749

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 74 GAC>GGC [Asp>Gly] HGVS Name: HBA2:c224A>G
Hb Name: Hb Liangqing Protein Info: N/A
Also known as: Hb Chapel Hill

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CTGACCAACGCCGTGGCGCACGTGG [A/G] CGACATGCCCAACGCGCTGTCCGCC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVGDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Found in a heterozygous state in a newborn female twin pair with no clinical presentation. HbX (11.6% and 12.7%) was separated from HbA by capillary electrophoresis. This variant was also found in a heterozygous state in three members of a Chinese family, all asymptomatic [PMID 3693273].

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34116
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Tang B, Wang J, Qin D, Yao C, Chen K, Liang L, Chai H, Guo H, Du L, Hb Chapel Hill or Alpha2 74(EF3) Asp>Gly, a mildly unstable variant found in a Chinese family., Hematology, 28(1), 2187154, 2023

Microattributions

A/AContributor(s)DateComments
1Li, Youqiong2021-02-24First report.
Created on 2021-02-24 17:01:52, Last reviewed on 2023-04-06 17:06:01 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.