IthaID: 3717
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
|---|---|---|---|
| Common Name: | CD 61 AAG>-AG | HGVS Name: | HBA1:c.184del |
| Hb Name: | N/A | Protein Info: | N/A |
Context nucleotide sequence:
TCTGCCCAGGTTAAGGGCCACGGCAAG [A/-] AGGTGGCCGACGCGCTGACCAACGCCG (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKRWPTRX
Also known as:
Comments: Found in a 34-year old pregnant Malay woman with Hb H disease, presented with Hb 10.2 g/dL, MCH 18 pg, MCV 59.7 fL and RBC 5.7 10^12/L. The woman was compound heterozygote of the novel mutation and the SEA deletion [IthaID: 309]. Hb analysis through CE shows HbA2 1.2 % and HbH 2.3 %. The T deletion, causing a frameshift that introduces a premature stop codon five amino acids further down the new reading frame.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
No available links
Phenotype
| Hemoglobinopathy Group: | Thalassaemia |
|---|---|
| Hemoglobinopathy Subgroup: | α-thalassaemia |
| Allele Phenotype: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 37880 |
| Size: | 1 bp |
| Located at: | α1 |
| Specific Location: | Exon 2 |
Other details
| Type of Mutation: | Point-Mutation(Deletion) |
|---|---|
| Effect on Gene/Protein Function: | Frameshift (Translation) |
| Ethnic Origin: | Malay |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Microattributions
| A/A | Contributor(s) | Date | Comments |
|---|---|---|---|
| 1 | Mohd Yasin, Norafiza | 2020-11-24 | First report. |