IthaID: 3712

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 140 TAC>TCC [Tyr>Ser] HGVS Name: HBA2:c.422A>C
Hb Name: Hb Angers Protein Info: α2 140(HC2) Tyr>Ser
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGTGAGCACCGTGCTGACCTCCAAAT [A/C] CCGTTAAGCTGGAGCCTCGGTAGCCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKSR

Comments: Found in a 75-year old man and his son presented with increased oxygen affinity and erythrocytosis. Both had low P50 value. The 32-year old son was compound heterozygous for the novel mutation and the 5’UTR mutation in the α2 gene HBA2:c.-24C>G [IthaID: 2481].

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34456
Size: 1 bp
Located at: α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Caucasian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Orvain C, Kiger L, Peronet I, Peron A, Galacteros F, Wajcman H, Pissard S, Hb Angers: A new α2-globin variant [α2 (140)(HC2) Tyr → Ser; HBA2: C.422 A>C] with increased oxygen affinity leading to erythrocytosis., Int J Lab Hematol, 2020
Created on 2021-01-15 11:41:17, Last reviewed on 2021-06-16 12:08:42 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.