IthaID: 3610


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 99 AAG>TAG [Lys>STOP] HGVS Name: HBA2:c.298A>T
Hb Name: N/A Protein Info: N/A

Context nucleotide sequence:
GGGTGGACCCGGTCAACTTC [A>T] AGGTGAGCGGCGGGCCGGGA (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFX

Also known as:

Comments: Detected during thalassemia screening in one person originating from Mazandaran province.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: α-thalassaemia
Allele Phenotype:N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34190
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Nonsense codon (Translation)
Ethnic Origin: Iranian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Hashemi-Soteh SMB, Karami H, Mousavi SS, Farazmandfar T, Tamadoni A, Alpha-globin gene mutation spectrum in patients with microcytic hypochromic anemia from Mazandaran Province, Iran., J. Clin. Lab. Anal., 34(1), e23018, 2020
Created on 2020-08-10 12:01:58, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.