IthaID: 3598
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 93/94 (-TG) [Cys>STOP] | HGVS Name: | HBD:c.282_283delTG |
Hb Name: | N/A | Protein Info: | p.Cys93Stop |
Context nucleotide sequence:
TTTTTCTCAGCTGAGTGAGCTGCACTG [TG/-] ACAAGCTGCACGTGGATCCTGA (Strand: -)
Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHX
Also known as:
Comments: Found in a 38-years old pregnant Spanish woman with normal clinical presentation. The 2-bp deletion creates a premature stop codon at the 93 amino acid. Hb X was not visible using HPLC but HbA2 was slightly low (1.3%).
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
Phenotype
Hemoglobinopathy Group: | Thalassaemia |
---|---|
Hemoglobinopathy Subgroup: | N/A |
Allele Phenotype: | δ0 |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 63592 |
Size: | 2 bp |
Located at: | δ |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Deletion) |
---|---|
Effect on Gene/Protein Function: | Nonsense codon (Translation) |
Ethnic Origin: | Spanish |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Publications / Origin
To the best of our knowledge, this is unpublished data. Please use with caution!
Created on 2020-06-30 15:04:19,
Last reviewed on 2020-06-30 15:06:06 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2020-06-30 15:04:19 | The IthaGenes Curation Team | Created |
2 | 2020-06-30 15:06:06 | The IthaGenes Curation Team | Reviewed. Common name corrected. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2024-12-12 10:33:52