IthaID: 3567


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 46 GGG>CGG [Gly>Arg] HGVS Name: HBB:c.139G>C
Hb Name: Hb Cenxi Protein Info: β 46(CD5) Gly>Arg

Context nucleotide sequence:
GACCCAGAGGTTCTTTGAGTCCTTT [G>C] GGGATCTGTCCACTCCTGATGCTGT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFRDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Reported as a heterozygote in one female individual during routine pregnancy thalassaemia screening (Hb 13.3 g/dL, MCV 81.9 fL, MCH 27.7 pg). The Hb variant was detected by CE but co-elutes with HbA2 by HPLC. Negative isopropanol stability test result.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70863
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Li YQ, Li YW, Liang L, Meng MH, Zhang XQ, First Detection of Hb Cenxi [β46(CD5)Gly→Arg (GG>GG), : c.139G>C] by Capillary Electrophoresis., Hemoglobin, 2020
Created on 2020-02-03 09:30:49, Last reviewed on 2020-02-03 09:31:31 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.