IthaID: 3379


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 139 AAA>CAA [Lys>Gln] HGVS Name: HBA2:c.418A>C
Hb Name: Hb Jilin Protein Info: α2 139(HC1) Lys>Gln

Context nucleotide sequence:
TTCTGTGAGCACCGTGCTGACCTCC [A>C] AATACCGTTAAGCTGGAGCCTCGGT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSQYR

Also known as:

Comments: Found in a heterozygous state. Perceived to be haematologically silent. Its chromatographic profile suggests a probable interference during the monitoring of glycated haemoglobin (HbA1c).

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:Silent Hb
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34452
Size: 1 bp
Located at: α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Xu A, Li J, Chen W, Ji L, Identification of a novel hemoglobin variant Hb Jilin [α139(HC1)Lys>Gln; HBA2:C.418 A>C] in a Chinese family., Int J Lab Hematol, 2018
Created on 2019-04-08 10:48:28, Last reviewed on 2019-04-09 11:26:53 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.