IthaID: 3361


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 138/139 (+T) HGVS Name: HBB:c.417dupT
Hb Name: N/A Protein Info: N/A

Context nucleotide sequence:
CAGAAAGTGGTGGCTGGTGTGGGCT [-/T] AATGCCCTGGCCCACAAGTATCACT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAX

Also known as:

Comments: The β-thal phenotype was derived using in silico predictors (SIFT and POLYPHEN). The insertion of a nt T between codon 138 and codon 139 creates a shift in the reading frame with a premature stop codon at codon 139 (TAA).

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:β0
Associated Phenotypes: Haemolytic anaemia [HP:0001878]
Ineffective erythropoiesis [HP:0010972]

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71991
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Lin F, Yang L, Lin M, Zheng X, Lu M, Qiu M, Li L, Xie L, [Rare thalassemia mutations among southern Chinese population]., Zhonghua Yi Xue Yi Chuan Xue Za Zhi , 34(6), 792-796, 2017
  2. Jiang F, Huang LY, Chen GL, Zhou JY, Xie XM, Li DZ, A Novel Frameshift Mutation at Codons 138/139 (HBB: c.417_418insT) on the β-Globin Gene Leads to β-Thalassemia., Hemoglobin, 41(1), 59-60, 2017
Created on 2019-04-04 15:51:19, Last reviewed on 2019-11-13 14:35:30 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.