IthaID: 3318

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 116 CGC>CTC [Arg>Leu] HGVS Name: HBD:c.350G>T
Hb Name: Hb A2-Lepore Protein Info: δ 116(G18) Arg>Leu
Also known as: Hb A2-India

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLALNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Comments: This new delta-globin variant was linked in cis with a beta(0)-thalassaemia mutation (CD 15 TGG>TAG). It was originally confused with Hb Lepore since it migrates in the same CE-CLHP window.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 64558
Size: 1 bp
Located at: δ
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: East Indian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Waye JS, Patterson M, Walker L, Eng B, Nakamura LM, Lafferty JD, Yong SL, Wu JK, Chui DH, Yong SL, Beta-thalassemia in association with a new delta-chain hemoglobin variant [delta116(g18)Arg-->Leu]: implications for carrier screening and prenatal diagnosis., Am. J. Hematol. , 74(3), 179-81, 2003
Created on 2018-02-15 16:55:04, Last reviewed on 2018-02-15 16:58:59 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.