IthaID: 3222

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 97 CAC>CGC [His>Arg] HGVS Name: HBD:c.293A>G
Hb Name: Hb A2-Merchang Protein Info: δ 97 His>Arg
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLRVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Comments: The mutation was found in a patient with an α-globin deletion spanning about 102 kb on the α-globin gene cluster from a position 9.3 kb upstream of the HBZ gene down to the ITFG-3 gene. The breakpoint was not determined. The HbA2 level was 1.1%. CE showed Zone 1 (HbA') peak (0.9%) typical of HbA2 variant.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63603
Size: 1 bp
Located at: δ
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Malaysian Malay
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Syahzuwan, Hassan2017-07-05First report.
Created on 2017-07-10 14:10:58, Last reviewed on 2017-07-18 10:06:01 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.