IthaID: 3093


Names and Sequences

Functionality: Disease modifying mutation Pathogenicity: N/A
Common Name: CD 316 TGC>TAC [Cys>Tyr] HGVS Name: NG_013087.1:g.7177G>A

Context nucleotide sequence:
AGCCATACGCCTGCACGTGGGAAGGCT [C/T] CGGCTGGAGATTCGCGCGCTCGG (Strand: -)

Protein sequence:
MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGYGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL

Also known as:

Comments: Protein change: C316Y. Found as a heterozygote in a Japanese patient with mild β-thalassaemia. Mutation is located on the second zinc finger domain and shown to affect its binding affinity to the β-globin promoter, resulting in reduced β-globin gene expression.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Allele Phenotype (Cis):N/A
Allele Phenotype (Trans):Decreased expression for β
Associated Phenotypes: Hb F levels [HP:0011904] [OMIM:141749]
Anaemia [HP:0001903]

Location

Chromosome: 19
Locus: NG_013087.1
Locus Location: 7177
Size: 1 bp
Located at: KLF1
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Japanese
Molecular mechanism: N/A
Inheritance: Quantitative trait
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Nitta T, Kawano F, Yamashiro Y, Takagi F, Murata T, Tanaka T, Ferania M, Adhiyanto C, Hattori Y, A new Krüppel-like factor 1 mutation (c.947G > A or p.C316Y) in humans causes β-thalassemia minor., Hemoglobin , 39(2), 121-6, 2015
Created on 2016-09-14 11:16:11, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.