IthaID: 3015


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 63 GCC>ACC [Ala>Thr] HGVS Name: HBA1:c.190G>A
Hb Name: Hb Greenville-NC Protein Info: α1 63(E12) Ala>Thr

Context nucleotide sequence:
GTTAAGGGCCACGGCAAGAAGGTG [G>A] CCGACGCGCTGACCAACGCCGTGGCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVTDALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

Comments: Reported in a pregnant 16 year old African American female with mild anemia, normocytic and normochromic red blood cells and increased red blood cell distribution width (RDW). Hb A, A2, S and two unknown alpha Hb variants were detected by HPLC and acid gel electrophoresis. Proband was heterozygous for c.190G>A in HBA1 (Hb Greenville-NC), c.146T>G in HBA2 (Hb Montgomery), and c.20A>T in HBB (Hb S). Relative percentages by mass spectrometry of different Hbs: Hb Greenville-NC 19%, Hb Montgomery 18%, and Hb S 40%. Proband's mother had a history of sickle cell trait and her father's hemoglobinopathy status was unknown. Source: 69th AACC Annual Scientific Meeting Abstract eBook, Abstract A-328, "Hemoglobin Greenville-North Carolina: A Novel Hemoglobinopathy Diagnosed At East Carolina University/Vidant Medical Center" by A. Thombare et al, https://www.myadlm.org/-/media/Files/Meetings-and-Events/Annual-Meeting/2017/AACC17_AbstractBookComplete_ClinChemV63S10.pdf?la

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37886
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African-American
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Created on 2016-08-24 12:18:55, Last reviewed on 2024-04-24 11:43:02 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.