IthaID: 2719


Names and Sequences

Functionality: Disease modifying mutation Pathogenicity: N/A
Common Name: rs1867380 HGVS Name: NG_011975.1:g.50874A>G

Context nucleotide sequence:
TCCAGAGCCTGACTCAGTCTTTAAG [A/G] CAGAACAATCTGAGGACAAACCAGA (Strand: +)

Protein sequence:
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKAEQSEDKPEKYELSVIM

Also known as:

Comments: SNP associated with HbF levels in the older subjects (≥24 years; n=538) of the Cooperative Study of Sickle Cell Disease (CSSCD). The association was replicated in an independent study, which enrolled sickle cell adult patients (n=211) from the Multicenter Study of Hydroxyurea in Sickle Cell Anemia (MSH). Also, AA was associated with an average increase of 6% in HbF compared with GG in response to hydroxyurea treatment in a cohort of SCA patients [http://doi.org/10.1182/blood.V104.11.108.108].

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Allele Phenotype (Cis):N/A
Allele Phenotype (Trans):N/A
Associated Phenotypes: Hb F levels [HP:0011904] [OMIM:141749]

Location

Chromosome: 15
Locus: NG_011975.2
Locus Location: 50874
Size: 1 bp
Located at: AQP9
Specific Location: Exon 6

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African American
Molecular mechanism: N/A
Inheritance: Quantitative trait
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Sebastiani P, Wang L, Nolan VG, Melista E, Ma Q, Baldwin CT, Steinberg MH, Fetal hemoglobin in sickle cell anemia: Bayesian modeling of genetic associations., Am. J. Hematol. , 83(3), 189-95, 2008
Created on 2016-05-13 09:58:57, Last reviewed on 2023-04-03 09:33:55 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.