IthaID: 2538
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
|---|---|---|---|
| Common Name: | CD 25 GGT>GAT [Gly>Asp] | HGVS Name: | HBA2:c.77G>A |
| Hb Name: | Hb Cibeles | Protein Info: | α2 25(B6) Gly>Asp |
Context nucleotide sequence:
GGTCGGCGCGCACGCTGGCGAGTATG [G/A] TGCGGAGGCCCTGGAGAGGTGAGGCTC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYDAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as:
Comments: Found in a heterozygous state. In the Hb Cibeles, an apolar amino acid [Gly] is replaced by a negatively charged amino acid [Asp], leading to an unastable Hb molecule.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
External Links
Phenotype
| Hemoglobinopathy Group: | Thalassaemia and Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-thalassaemia, α-chain variant |
| Allele Phenotype: | α⁺ |
| Stability: | Hyperunstable |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | Haemolytic anaemia [HP:0001878] |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 33852 |
| Size: | 1 bp |
| Located at: | α2 |
| Specific Location: | Exon 1 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | Ethiopian |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- de la Fuente-Gonzalo F, Nieto JM, Vinuesa L, Sevilla J, Díaz-Mediavilla J, Villegas A, González FA, Ropero P, Hb Cibeles [α2 CD25(B6) (Gly → Asp)]: a novel alpha chain variant causing alpha-thalassemia., Int. J. Hematol. , 2014
Created on 2014-10-10 10:35:09,
Last reviewed on 2019-04-04 16:08:28 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.