IthaID: 2315
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
|---|---|---|---|
| Common Name: | CD 110 GCC>GTC [Ala>Val] | HGVS Name: | HBA1:c.332C>T |
| Hb Name: | Hb Montluel | Protein Info: | α1 110(G17) Ala>Val |
Context nucleotide sequence:
AGCCACTGCCTGCTGGTGACCCTGG [C/T] CGCCCACCTCCCCGCCGAGTTCACC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLVAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as: Hb White Rose
Comments: Found in a 75-year-old French Caucasian male suffering from Waldenstrom disease presented with Hb 10 g/dL, MCV 94 fL, MCH 32.3 pg. HPLC analysis shown normal levels of Hb A2 2.5 %, Hb F 0.5 % and an abnormal peak of 14.5 %. Hb White Rose is the corresponding HBA1 or HBA2 variant (first report).
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 38177 |
| Size: | 1 bp |
| Located at: | α1 |
| Specific Location: | Exon 3 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | British, French Caucasian |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- Renoux C, Feray C, Joly P, Lacan P, Francina A, Description of Three New α Variants and Four New β Variants: Hb Montluel [α110(G17)Ala → Val; HBA1: c.332C > T], Hb Cap d'Agde [α131(H14)Ser → Cys; HBA2: c.395C > G] and Hb Corsica [α100(G7)Leu → Pro; HBA1: 302T > C]; Hb Nîmes [β104(G6)Arg → Gly; HBB: c.313A > G], Hb Saint Marcellin [β112(G14)Cys → Gly; HBB: c.337T > G], Hb Saint Chamond [β80(EF4)Asn → 0; HBB: c.241_243delAAC] and Hb Dompierre [β29(B11)Gly → Arg; HBB: c.88G > C]., Hemoglobin, 39(3), 147-51, 2015
Created on 2014-01-10 13:59:52,
Last reviewed on 2021-03-16 09:14:36 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.