IthaID: 179
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 75 (-C) | HGVS Name: | HBB:c.226delC |
Hb Name: | N/A | Protein Info: | N/A |
Context nucleotide sequence:
GTGCTCGGTGCCTTTAGTGATGGC [C/-] TGGCTCACCTGGACAACCTCAAGG (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGWLTWTTSRAPLPHX
Also known as:
Comments: The T deletion at codon 75, creating a change in the reading frame that results in a premature termination of translation because of a stop codon at codon 88 (TGA).
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Thalassaemia |
---|---|
Hemoglobinopathy Subgroup: | β-thalassaemia |
Allele Phenotype: | β0 |
Associated Phenotypes: |
Haemolytic anaemia [HP:0001878] Ineffective erythropoiesis [HP:0010972] |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70950 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Deletion) |
---|---|
Effect on Gene/Protein Function: | Frameshift (Translation) |
Ethnic Origin: | Turkish |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | No |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Frequencies
Publications / Origin
- Başak AN, Ozçelik H, Ozer A, Tolun A, Aksoy M, Ağaoğlu L, Ridolfi F, Ulukutlu L, Akar N, Gürgey A, The molecular basis of beta-thalassemia in Turkey., Human genetics, 89(3), 315-8, 1992
- Başak AN, Ozer A, Ozçelik H, Kirdar B, Gürgey A, A novel frameshift mutation: deletion of C in codons 74/75 of the beta-globin gene causes beta zero-thalassemia in a Turkish patient., Hemoglobin, 16(4), 309-12, 1992
Created on 2010-06-16 16:13:15,
Last reviewed on 2021-04-08 12:55:21 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:15 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:28:32 | The IthaGenes Curation Team | Reviewed. |
3 | 2019-09-27 10:44:28 | The IthaGenes Curation Team | Reviewed. HGVS name and Comment added. |
4 | 2021-04-08 12:54:09 | The IthaGenes Curation Team | Reviewed. |
5 | 2021-04-08 12:55:21 | The IthaGenes Curation Team | Reviewed. HGVS and common name corrected. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2024-04-24 11:43:02