IthaID: 1457


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 125 GAG>GCG HGVS Name: HBG2:c.377A>C
Hb Name: Hb F-Port Royal Protein Info: Gγ 125(H3) Glu>Ala

Context nucleotide sequence:
CATTTCGGCAAAGAATTCACCCCTG [A/C/T] GGTGCAGGCTTCCTGGCAGAAGATG (Strand: -)

Protein sequence:
MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPAVQASWQKMVTGVASALSSRYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: γ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 44272
Size: 1 bp
Located at:
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: African
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Brimhall B, Vedvick TS, Jones RT, Ahern E, Palomino E, Ahern V, Haemoglobin F Port Royal (alpha2G gamma2 125 Glu leads to Ala)., British journal of haematology, 27(2), 313-8, 1974
Created on 2010-06-16 16:13:17, Last reviewed on 2013-10-15 17:00:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.