IthaID: 1390


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 136 GGT>GAT [Gly>Asp] HGVS Name: HBD:c.410G>A
Hb Name: Hb A2-Babinga Protein Info: δ 136(H14) Gly>Asp

Context nucleotide sequence:
GCTGCCTATCAGAAGGTGGTGGCTG [A/G] TGTGGCTAATGCCCTGGCTCACAAG (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVADVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 64618
Size: 1 bp
Located at: δ
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: African
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Frequencies

Publications / Origin

  1. de Jong WW, Bernini LF, Haemoglobin Babinga (delta 136 glycine-aspartic acid): a new delta chain variant., Nature, 219(5161), 1360-2, 1968
  2. Huisman TH, Reynolds CA, Dozy AM, Wilson JB, Hemoglobin Babinga or alpha 2 delta 2 136 Gly--Asp observed in the American Negro., Biochim. Biophys. Acta , 175(1), 223-5, 1969
  3. McRoyan DK, Liu PI, Mankad VN, Wilson JB, Huisman TH, Hb A2-Babinga, Hb S, and HPFH in members of a family from Creola, Alabama., Hemoglobin , 8(4), 413-6, 1984
Created on 2010-06-16 16:13:17, Last reviewed on 2014-05-02 09:23:25 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.