IthaID: 1386


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 117 AAC>GAC HGVS Name: HBD:c.352A>G
Hb Name: Hb A2-Liangcheng Protein Info: δ 117(G19) Asn>Asp

Context nucleotide sequence:
TGTGCTGGTGTGTGTGCTGGCCCGC [A/G] ACTTTGGCAAGGAATTCACCCCACA (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARDFGKEFTPQMQAAYQKVVAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: δ-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 64560
Size: 1 bp
Located at: δ
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Qin WB, Ju TL, Yue XL, Yan XL, Qin LY, Molchanova TP, Pobedimskaya DD, Huisman TH, Hb A2-liangcheng [delta 117(G19)Asn->Asp(AAC->GAC)]: a new delta chain variant detected by gene analysis in a Chinese family., Hemoglobin, 17(5), 463-6, 1993
  2. Liu N, Xie XM, Zhou JY, Li R, Liao C, Li DZ, Analysis of δ-globin gene mutations in the Chinese population., Hemoglobin , 37(1), 85-93, 2013
Created on 2010-06-16 16:13:17, Last reviewed on 2017-07-11 16:41:23 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.