IthaID: 1333


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 30 (AGG>ACG) HGVS Name: HBD:c.92G>C
Hb Name: N/A Protein Info: delta 30(B12) Arg>Thr

Context nucleotide sequence:
GCAGTTGGTGGTGAGGCCCTGGGCA [C/G] GTTGGTATCAAGGTTATAAGAGAGG (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGTLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: δ-thalassaemia
Allele Phenotype:δ0
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 63274
Size: 1 bp
Located at: δ
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Italian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Frequencies

Publications / Origin

  1. Pirastu M, Ristaldi MS, Loudianos G, Murru S, Sciarratta GV, Parodi MI, Leone D, Agosti S, Cao A, Molecular analysis of atypical beta-thalassemia heterozygotes., Annals of the New York Academy of Sciences, 612(0), 90-7, 1990
Created on 2010-06-16 16:13:17, Last reviewed on 2013-10-15 17:27:30 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.