IthaID: 1279


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 139 AAT>TAT [Asn>Tyr]; CD 138 (-GCT) [-Ala] HGVS Name: HBB:c.[418A>T;415_417delGCT]
Hb Name: Hb Nijkerk Protein Info: β 139(H17) Asn>Tyr AND β 138(H16) Ala->0

Context nucleotide sequence:
TCAGAAAGTGGTGGCTGGTGTGGCT [A/G/T] ATGCCCTGGCCCACAAGTATCACTA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAYALAHKYH

Also known as: Hb Nykerk

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: Haemolytic anaemia [HP:0001878]

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71992
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Dutch
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. van den Berg HM, Bruin MC, Batelaan D, van Delft P, van Zwieten R, Roos D, Harteveld CL, Bernini LF, Giordano PC, Hb Nijkerk: a new mutation at codons 138/139 of the beta-globin gene inducing severe hemolytic anemia in a Dutch girl., Hemoglobin , 23(2), 135-44, 1999
Created on 2010-06-16 16:13:17, Last reviewed on 2014-04-15 19:09:44 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.