IthaID: 1274
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
---|---|---|---|
Common Name: | CD 138 GCT>CCT [Ala>Pro] | HGVS Name: | HBB:c.415G>C |
Hb Name: | Hb Brockton | Protein Info: | β 138(H16) Ala>Pro |
Context nucleotide sequence:
CTATCAGAAAGTGGTGGCTGGTGTG [A/C/G] CTAATGCCCTGGCCCACAAGTATCA (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVPNALAHKYH
Also known as:
Comments: The substituted proline disrupts intermolecular hydrogen bonding between β138Ala and β134Val in helix H, producing an unstable haemoglobin variant with a propensity to precipitate and aggregate. Variant does not show altered O2 binding affinity or electrophoretic mobility shifts.
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | Haemolytic anaemia [HP:0001878] |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 71989 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Caucasian, Chinese, Turkish |
Molecular mechanism: | Altered secondary structure |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Publications / Origin
- Ulukutlu L, Ozsahin H, Wilson JB, Webber BB, Hu H, Kutlar A, Kutlar F, Huisman TH, Hb Brockton [alpha 2 beta 2138(H16)Ala----Pro] observed in a Turkish girl., Hemoglobin, 13(5), 509-13, 1989
- Thom CS, Dickson CF, Gell DA, Weiss MJ, Hemoglobin variants: biochemical properties and clinical correlates., Cold Spring Harb Perspect Med, 3(3), a011858, 2013
Created on 2010-06-16 16:13:17,
Last reviewed on 2019-06-19 12:15:00 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:17 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2015-12-03 16:33:33 | The IthaGenes Curation Team | Reviewed. Phenotype updated |
4 | 2019-06-19 12:15:00 | The IthaGenes Curation Team | Reviewed. Comment and Refence added. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2024-11-20 13:24:07