IthaID: 1263


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 134 GTG>GCG HGVS Name: HBB:c.404T>C
Hb Name: Hb Yaounde Protein Info: β 134(H12) Val>Ala

Context nucleotide sequence:
GTGCAGGCTGCCTATCAGAAAGTGG [A/C/G/T] GGCTGGTGTGGCTAATGCCCTGGCC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVAAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71978
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Cameroonian | Portuguese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
178Hb YaoundeβD-10Dual Kit Program731.72Clinically normal. Elutes as HbA. [PDF]
179Hb YaoundeβVARIANTβ-thal Short Program76.52.46Clinically normal. Elutes as HbA. [PDF]
180Hb YaoundeβVARIANT IIβ-thal Short Program75.22.55Clinically normal. Elutes as HbA. [PDF]
181Hb YaoundeβVARIANT IIDual Kit Program73.21.822Clinically normal. Elutes as HbA. [PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Yapo AP, Promé D, Claparols C, Riou J, Galactéros F, Wajcman H, Hb Yaoundé [beta134(H12)Val-->Ala], a new neutral variant found in association with Hb Kenitra., Hemoglobin, 25(1), 97-101, 2001
Created on 2010-06-16 16:13:17, Last reviewed on 2013-10-15 17:00:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.