IthaID: 1246


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 129 GCC>GAC [Ala>Asp] HGVS Name: HBB:c.389C>A
Hb Name: Hb J-Taichung Protein Info: β 129(H7) Ala>Asp

Context nucleotide sequence:
GAATTCACCCCACCAGTGCAGGCTG [C>A] CTATCAGAAAGTGGTGGCTGGTGTG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQADYQKVVAGVANALAHKYH

Also known as: Hb K-Cameroon

Comments: Hb J-Taichung was detected by haemoglobin electrophoresis and DNA sequencing, and reported as a non-pathological, stable β-chain variant that does not produce anaemia. It is characterized by replacement of the alanyl residue at position β129 in the H-helix (Η7) by a negatively charged aspartyl residue. Also reported in public databases as Hb K-Cameroon (HBB:p.[Ala130Asp or Ala130Glu]) based on an incomplete protein analysis.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71963
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Chinese, Taiwanese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Blackwell RQ, Yang HJ, Wang CC, Hemoglobin J Taichung:beta-129 ALA--ASP., Biochimica et biophysica acta, 194(1), 1-5, 1969
  2. Lin TH, Er TK, Liu SC, Lin IC, Cheng HL, Peng CT, Shih HC, Chang JG, Molecular characterisation and diagnosis of Hb J-Taichung (129[H7]Ala-->Asp) in a Taiwanese family subject., Br. J. Biomed. Sci., 67(1), 31-4, 2010
Created on 2010-06-16 16:13:17, Last reviewed on 2023-04-28 14:05:34 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.