IthaID: 1166


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 106 CTG>CCG [Leu>Pro] HGVS Name: HBB:c.320T>C
Hb Name: Hb Southampton Protein Info: β 106(G8) Leu>Pro

Context nucleotide sequence:
CCTCTTATCTTCCTCCCACAGCTCC [A/C/G/T] GGGCAACGTGCTGGTCTGTGTGCTG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLPGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as: Hb Casper

Comments: Rare haemoglobin (Hb) variant reported as a de novo mutation in a handful of patients from various ethnic backgrounds. The β106 Leu>Pro substitution disrupts the alpha helix of the β-chain and alters the tertiary structure of the Hb molecule at a point where there is direct contact with heme, resulting in the loss of the heme group. The variant can be detected by isoelectric focusing (IEF) but it is electrophoretically silent in conventional Hb electrophoresis. Detection of inclusion bodies and highly unstable Hb.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Hyperunstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71894
Size: 1 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Argentinean | Caucasian | English | Uruguayan | Chinese | Hispanic
Molecular mechanism: Altered heme pocket
Inheritance: Recessive
DNA Sequence Determined: Yes

Publications / Origin

  1. Hyde RD, Hall MD, Wiltshire BG, Lehmann H, Haemoglobin Southampton, 106 (G8) Leu leads to pro: an unstable variant producing severe haemolysis., Lancet, 2(7788), 1170-2, 1972
  2. Koler RD, Jones RT, Bigley RH, Litt M, Lovrien E, Brooks R, Lahey ME, Fowler R, Hemoglobin Casper: beta 106 (G8) Leu leads to Pro; a contemporary mutation., The American journal of medicine, 55(3), 549-58, 1973
  3. Wajcman H, Gacon G, Labie D, Koler RD, Jones RT, Isolation and functional characterization of hemoglobin Casper: beta106(G8) Leu replaced by Pro., Biochemistry, 14(22), 5017-20, 1975
  4. Didkovskiĭ NA, Idel'son LI, Filippova AV, Lemann G, [A new case of the unstable hemoglobin Southampton--Casper(beta106) (G68) leucine--proline)]., Probl Gematol Pereliv Krovi, 21(6), 48-50, 1976
  5. Heintz NH, Howard PL, Hemoglobin Southampton (Casper): characterization of the base mutation., Am. J. Hematol., 30(1), 1-3, 1989
  6. Eandi Eberle S, Noguera NI, Sciuccati G, Bonduel M, Díaz L, Staciuk R, Feliu-Torres A, Hb Southampton [beta106(G8)Leu-->Pro, CTG-->CCG] in an Argentinean boy., Hemoglobin, 30(3), 401-3, 2006
  7. Avalos Gómez V, Eandi Eberle S, Pepe C, Sciuccati G, García Rosolen N, Cervio C, Díaz L, Candás A, Bonduel M, Piazza G, Chaves D, Feliú Torres A, [Severe hemolytic anemia due to hemoglobin Southampton: case report]., Arch Argent Pediatr, 110(5), e91-4, 2012
  8. Pereira JA, López P, Costa FF, Sans M, Sonati Mde F, Hb Southampton [B106(G8)Leu→PRO, CTG→CCG] in a Uruguayan woman., Rev Bras Hematol Hemoter, 35(2), 146-7, 2013
  9. Haque A, Quint DJ, Castle VP, Leber SM, Another Rare Unstable Hemoglobinopathy: Hemoglobin Casper/Southampton Associated with Moyamoya Disease., Cerebrovasc Dis Extra, 5(2), 52-4, 2015
  10. Liu J, Huang Y, Lei Y, Lai Y, Hb Southampton [β106(G8)Leu→Pro; HBB: c.320T>C] and Codons 41/42 (-TTCT; HBB: c.124_127delTTCT) in a Chinese Girl., Hemoglobin, 41(2), 134-136, 2017
Created on 2010-06-16 16:13:16, Last reviewed on 2019-05-16 12:34:19 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.