IthaID: 1154


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 102 AAC>AAA or AAG HGVS Name: HBB:c.309C>A | HBB:c.309C>G
Hb Name: Hb Richmond Protein Info: β 102(G4) Asn>Lys

Context nucleotide sequence:
ACAAGCTGCACGTGGATCCTGAGAA [A/C/G] TTCAGGGTGAGTCTATGGGACGCTT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPEKFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71033
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: African
Molecular mechanism: Altered α1β1 interface
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Publications / Origin

  1. Efremov GD, Huisman TH, Smith LL, Wilson JB, Kitchens JL, Wrightstone RN, Adams HR, Hemoglobin Richmond, a human hemoglobin which forms asymmetric hybrids with other hemoglobins., The Journal of biological chemistry, 244(22), 6105-16, 1969
Created on 2010-06-16 16:13:16, Last reviewed on 2023-03-07 14:32:40 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.