
IthaID: 1121
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 95 AAG>AAY [Lys>Asn] | HGVS Name: | HBB:c.288G>Y |
Hb Name: | Hb Detroit | Protein Info: | β 95(FG2) Lys>Asn |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CACTGAGTGAGCTGCACTGTGACAA [G>C] CTGCACGTGGATCCTGAGAACTTCA (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDNLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Comments: Reported as a β95 (FG2) Lys>Asn [AAG>AAC or AAT] change by amino acid analysis in a female subject from India without hematological abnormalities. The variant Hb was detected by cellulose acetate electrophoresis and column chromatography on DEAE-Sephadex. It was shown to migrate between Hb A and Hb J Baltimore. Could not be detected by electrophoresis on citrate agar gel. Hb stability tests and oxygen affinity studies were normal.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 71012 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | N/A |
Ethnic Origin: | Indian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | No |
In silico pathogenicity prediction
Publications / Origin
- Moo-Penn WF, Schneider RG, Andrian S, Das DK, Hemoglobin Detroit: beta95 (FG2) lysine leads to asparagine., Biochimica et biophysica acta, 536(1), 283-8, 1978