IthaID: 1090

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 87 ACA>AAA HGVS Name: HBB:c.263C>A
Hb Name: Hb D-Ibadan Protein Info: β 87(F3) Thr>Lys
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GACAACCTCAAGGGCACCTTTGCCA [A/C/T] ACTGAGTGAGCTGCACTGTGACAAG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70987
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: Nigerian
Molecular mechanism: Altered interaction with HbS polymer
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
317Hb D-IbadanβD-10Dual Kit Program34.13.51Carrier. Clinically normal. [PDF]
318Hb D-IbadanβVARIANTβ-thal Short Program39.13.85Carrier. Clinically normal. [PDF]
319Hb D-IbadanβVARIANT IIβ-thal Short Program39.13.94Carrier. Clinically normal. [PDF]
320Hb D-IbadanβVARIANT IIDual Kit Program35.83.17Carrier. Clinically normal. [PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Castro O, Winter WP, Bullock WH, Jilly PN, Gvozden AB, Rucknagel DL, Hemoglobin D Ibadan trait in combination with sigma beta thalassemia., Hemoglobin, 3(1), 77-82, 1979
Created on 2010-06-16 16:13:16, Last reviewed on 2013-10-15 17:00:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.