IthaID: 1090
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
|---|---|---|---|
| Common Name: | CD 87 ACA>AAA | HGVS Name: | HBB:c.263C>A |
| Hb Name: | Hb D-Ibadan | Protein Info: | β 87(F3) Thr>Lys |
Context nucleotide sequence:
GACAACCTCAAGGGCACCTTTGCCA [A/C/T] ACTGAGTGAGCTGCACTGTGACAAG (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as:
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | β-chain variant |
| Allele Phenotype: | N/A |
| Stability: | N/A |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 70987 |
| Size: | 1 bp |
| Located at: | β |
| Specific Location: | Exon 2 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | N/A |
| Ethnic Origin: | Nigerian |
| Molecular mechanism: | Altered interaction with HbS polymer |
| Inheritance: | Recessive |
| DNA Sequence Determined: | No |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
| ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
|---|---|---|---|---|---|---|---|---|---|
| 317 | Hb D-Ibadan | β | D-10 | Dual Kit Program | 34.1 | 3.51 | Carrier. Clinically normal. | [PDF] | |
| 318 | Hb D-Ibadan | β | VARIANT | β-thal Short Program | 39.1 | 3.85 | Carrier. Clinically normal. | [PDF] | |
| 319 | Hb D-Ibadan | β | VARIANT II | β-thal Short Program | 39.1 | 3.94 | Carrier. Clinically normal. | [PDF] | |
| 320 | Hb D-Ibadan | β | VARIANT II | Dual Kit Program | 35.8 | 3.17 | Carrier. Clinically normal. | [PDF] |
In silico pathogenicity prediction
Publications / Origin
- Castro O, Winter WP, Bullock WH, Jilly PN, Gvozden AB, Rucknagel DL, Hemoglobin D Ibadan trait in combination with sigma beta thalassemia., Hemoglobin, 3(1), 77-82, 1979
Created on 2010-06-16 16:13:16,
Last reviewed on 2013-10-15 17:00:14 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.