IthaID: 1050
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 75 CTG>CCG; CD 141 (-CTG) | HGVS Name: | HBB:c.[227T>C;424_426delCTG] |
Hb Name: | Hb Atlanta-Coventry | Protein Info: | β 75(E19) Leu>Pro AND β 141(H19) Leu->0 |
Context nucleotide sequence:
AGTGGTGGCTGGTGTGGCTAATGCC [-/CTG] GCCCACAAGTATCACTAAGCTCGCT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGPAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Also known as:
Comments: Hb Atlanta-Coventry (βAt-Co) was initially proposed to contain two mutations, β75 Leu>Pro (Hb Atlanta) and β141 Leu deleted (Hb Coventry). It is now proposed that β141 Leu is not deleted but it is likely to be a hydroxyleucine, which results from the post-translational oxidation of β141 Leu as a consequence of perturbation of the haem environment caused by the β75 Leu>Pro mutation in the E helix (E19).
We follow the HGVS sequence variant nomenclature and IUPAC standards.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | N/A |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70951 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Deletion) |
---|---|
Effect on Gene/Protein Function: | N/A |
Ethnic Origin: | N/A |
Molecular mechanism: | Altered secondary structure |
Inheritance: | Recessive |
DNA Sequence Determined: | No |
In silico pathogenicity prediction
Publications / Origin
- Brennan SO, Shaw J, Allen J, George PM, Beta 141 Leu is not deleted in the unstable haemoglobin Atlanta-Coventry but is replaced by a novel amino acid of mass 129 daltons., British journal of haematology, 81(1), 99-103, 1992
- Brennan SO, Shaw JG, George PM, Huisman TH, Posttranslational modification of beta 141 Leu associated with the beta 75(E19)Leu-->Pro mutation in Hb Atlanta., Hemoglobin, 17(1), 1-7, 1993
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2010-06-16 16:13:16 | The IthaGenes Curation Team | Created |
2 | 2013-10-15 17:00:14 | The IthaGenes Curation Team | Reviewed. |
3 | 2021-11-29 16:45:24 | The IthaGenes Curation Team | Reviewed. Reference and Comment added. |
4 | 2021-11-29 16:48:52 | The IthaGenes Curation Team | Reviewed. Reference. |