IthaID: 1040

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 73 GAT>AAT HGVS Name: HBB:c.220G>A
Hb Name: Hb G-Accra Protein Info: β 73(E17) Asp>Asn
Also known as: Hb Korle-Bu

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CAAGAAAGTGCTCGGTGCCTTTAGT [A/G/T] ATGGCCTGGCTCACCTGGACAACCT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSNGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70944
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: African
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
384Hb G-AccraβD-10Dual Kit Program40.63.53Normal in the heterozygote.[PDF]
385Hb G-AccraβVARIANTβ-thal Short Program43.93.88Normal in the heterozygote. [PDF]
386Hb G-AccraβVARIANT IIβ-thal Short Program43.53.89Normal in the heterozygote. [PDF]
387Hb G-AccraβVARIANT IIDual Kit Program43.13.144Normal in the heterozygote.[PDF]

In silico pathogenicity prediction

Frequencies

Publications / Origin

  1. Konotey-Ahulu FI, Gallo E, Lehmann H, Ringelhann B, Haemoglobin Korle-Bu (beta 73 aspartic acid replaced by asparagine) showing one of the two amino acid substitutions of haemoglobin C Harlem., Journal of medical genetics, 5(2), 107-11, 1968
  2. Nagel RL, Lin MJ, Witkowska HE, Fabry ME, Bestak M, Hirsch RE, Compound heterozygosity for hemoglobin C and Korle-Bu: moderate microcytic hemolytic anemia and acceleration of crystal formation [corrected]., Blood , 82(6), 1907-12, 1993
Created on 2010-06-16 16:13:16, Last reviewed on 2017-04-18 11:41:37 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.