IthaID: 1010


Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 63 CAT>CCT HGVS Name: HBB:c.191A>C
Hb Name: Hb Bicêtre Protein Info: β 63(E7) His>Pro

Context nucleotide sequence:
ATGGGCAACCCTAAGGTGAAGGCTC [A/C/G] TGGCAAGAAAGTGCTCGGTGCCTTT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAPGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70915
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: N/A
Ethnic Origin: American | French
Molecular mechanism: Altered heme pocket
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
73Hb BicêtreβD-10Dual Kit Program83.41.69Unstable variant. Elutes with HbA.[PDF]
74Hb BicêtreβVARIANTβ-thal Short Program80.62.34Unstable variant. Elutes with HbA.[PDF]
75Hb BicêtreβVARIANT IIβ-thal Short Program85.22.5Unstable variant. Elutes with HbA.[PDF]
76Hb BicêtreβVARIANT IIDual Kit Program83.81.8Unstable variant. Elutes with HbA.[PDF]

In silico pathogenicity prediction

Publications / Origin

  1. Miller DR, Wilson JB, Kutlar A, Huisman TH, Hb Bicêtre or alpha 2 beta(2)63(E7)His----Pro in a white male: clinical observations over a period of 25 years., American journal of hematology, 21(2), 209-14, 1986
Created on 2010-06-16 16:13:16, Last reviewed on 2013-10-15 17:00:14 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.